PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00029835-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family Dof
Protein Properties Length: 323aa    MW: 35958.4 Da    PI: 6.7826
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00029835-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.33.4e-384099261
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                        +++alkcprCds ntkfCyynny+ sqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  WALNUT_00029835-RA 40 HHQALKCPRCDSLNTKFCYYNNYNQSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKAKRS 99
                        57899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027016.6E-334298IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-244393IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2084498IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104682IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MQEIHSIGGG GRLFGGVGGG GADRRLRLHH QYHNHQQQNH HQALKCPRCD SLNTKFCYYN  60
NYNQSQPRHF CKSCRRYWTK GGVLRNVPVG GGCRKAKRSK PKPASSDTST PQPQRQRERK  120
SNSNSSSESS SLTATNTNAA TEAVSTEVPS LNSYSNLLNV QDSKLFISNP SFETGLLEQG  180
SDCGIFSEIG SFTSLITASS EALPFGFNGV SETTPFRLNH QSHDRHQQQQ WQQEEQQQCK  240
AMMRGMVGEE TEIQQEITGE LVDQTVQLDL PSLQDRSSGG GFGSLDWQVS GDQDLFDLPN  300
TVDQAYWSQS QWADQDHPSL YLP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6629176e-60KP662917.1 Cajanus cajan Dof25 (Dof25) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015883277.11e-107PREDICTED: dof zinc finger protein DOF5.4
TrEMBLW9RP281e-107W9RP28_9R
STRINGVIT_17s0000g04850.t012e-80(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.11e-46OBF binding protein 4